NEU2 Antibody
Artikelnummer:
ASB-ARP64280_P050
- Bilder (4)
| Artikelname: | NEU2 Antibody |
| Artikelnummer: | ASB-ARP64280_P050 |
| Hersteller Artikelnummer: | ARP64280_P050 |
| Alternativnummer: | ASB-ARP64280_P050-25UL,ASB-ARP64280_P050-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Proteine/Peptide |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH |
| Alternative Synonym: | SIAL2 |
| This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. |




