NEU2 Antibody
Catalog Number:
ASB-ARP64280_P050
- Images (4)
| Article Name: | NEU2 Antibody |
| Biozol Catalog Number: | ASB-ARP64280_P050 |
| Supplier Catalog Number: | ARP64280_P050 |
| Alternative Catalog Number: | ASB-ARP64280_P050-25UL,ASB-ARP64280_P050-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Proteine/Peptide |
| Application: | IHC |
| Species Reactivity: | Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH |
| Alternative Names: | SIAL2 |
| This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3ug/mL of the antibody was used in this experiment. |
|
|
Rabbit Anti-NEU2 antibody Catalog Number: ARP64280 Formalin Fixed Paraffin Embedded Tissue: Human Adrenal Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Rabbit Anti-NEU2 antibody Catalog Number: ARP64280 Formalin Fixed Paraffin Embedded Tissue: Human Placenta Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
NEU2 Antibody (ARP64280_P050) in Human Adrenal using Immunohistochemistry |
Product Guarantee and Expert Support
