CD93 Protein

Artikelnummer: BYT-ORB1476715
Artikelname: CD93 Protein
Artikelnummer: BYT-ORB1476715
Hersteller Artikelnummer: orb1476715
Alternativnummer: BYT-ORB1476715-1,BYT-ORB1476715-100,BYT-ORB1476715-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This CD93 Protein spans the amino acid sequence from region 24-581aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 60.2 kDa
UniProt: A0A2K5VH53
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEG
Anwendungsbeschreibung: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CD93 at 2 µg/ml can bind Anti-CD93 recombinant antibody, the EC50 is 0.1669-0.3513 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CD93 at 2 µg/ml can bind Anti-CD93 recombinant antibody, the EC50 is 0.1669-0.3513 ng/mL.
The purity of CD93 was greater than 95% as determined by SEC-HPLC