CD93 Protein
Catalog Number:
BYT-ORB1476715
- Images (3)
| Article Name: | CD93 Protein |
| Biozol Catalog Number: | BYT-ORB1476715 |
| Supplier Catalog Number: | orb1476715 |
| Alternative Catalog Number: | BYT-ORB1476715-1,BYT-ORB1476715-100,BYT-ORB1476715-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| This CD93 Protein spans the amino acid sequence from region 24-581aa. Purity: Greater than 95% as determined by SDS-PAGE. |
| Molecular Weight: | 60.2 kDa |
| UniProt: | A0A2K5VH53 |
| Buffer: | Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Source: | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEG |
| Application Notes: | Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CD93 at 2 µg/ml can bind Anti-CD93 recombinant antibody, the EC50 is 0.1669-0.3513 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



