Mouse Cirbp protein

Artikelnummer: BYT-ORB603976
Artikelname: Mouse Cirbp protein
Artikelnummer: BYT-ORB603976
Hersteller Artikelnummer: orb603976
Alternativnummer: BYT-ORB603976-20,BYT-ORB603976-100,BYT-ORB603976-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: A18 hnRNP Glycine-rich RNA-binding protein CIRP Cirp
This Mouse Cirbp protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 22.6 kDa
UniProt: P60824
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.