Mouse Cirbp protein

Catalog Number: BYT-ORB603976
Article Name: Mouse Cirbp protein
Biozol Catalog Number: BYT-ORB603976
Supplier Catalog Number: orb603976
Alternative Catalog Number: BYT-ORB603976-20,BYT-ORB603976-100,BYT-ORB603976-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: A18 hnRNP Glycine-rich RNA-binding protein CIRP Cirp
This Mouse Cirbp protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.6 kDa
UniProt: P60824
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.