Porcine CLCA1 protein
Artikelnummer:
BYT-ORB605158
- Bilder (3)
| Artikelname: | Porcine CLCA1 protein |
| Artikelnummer: | BYT-ORB605158 |
| Hersteller Artikelnummer: | orb605158 |
| Alternativnummer: | BYT-ORB605158-1,BYT-ORB605158-100,BYT-ORB605158-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Calcium-activated chloride channel family member 1 pCLCA1 AECC |
| This Porcine CLCA1 protein spans the amino acid sequence from region 46-199aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 22.8 kDa |
| UniProt: | Q9TUB5 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Sus scrofa (Pig) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ |
| Anwendungsbeschreibung: | Biological Origin: Sus scrofa (Pig). Application Notes: Partial |



