Porcine CLCA1 protein
Catalog Number:
BYT-ORB605158
- Images (3)
| Article Name: | Porcine CLCA1 protein |
| Biozol Catalog Number: | BYT-ORB605158 |
| Supplier Catalog Number: | orb605158 |
| Alternative Catalog Number: | BYT-ORB605158-1,BYT-ORB605158-100,BYT-ORB605158-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Calcium-activated chloride channel family member 1 pCLCA1 AECC |
| This Porcine CLCA1 protein spans the amino acid sequence from region 46-199aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 22.8 kDa |
| UniProt: | Q9TUB5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Sus scrofa (Pig) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ |
| Application Notes: | Biological Origin: Sus scrofa (Pig). Application Notes: Partial |



