Polyclonal Rabbit anti-Human MYOT / Myotilin Antibody (IHC, IF, WB) LS-C334718

Artikelnummer: LS-C334718-100
Artikelname: Polyclonal Rabbit anti-Human MYOT / Myotilin Antibody (IHC, IF, WB) LS-C334718
Artikelnummer: LS-C334718-100
Hersteller Artikelnummer: LS-C334718-100
Alternativnummer: LS-C334718-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 259-314 of human MYOT (NP_001129412.1). RPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL
Konjugation: Unconjugated
Alternative Synonym: MYOT, 57 kDa cytoskeletal protein, LGMD1, LGMD1A, TTID, Myotilin
Myotilin antibody LS-C334718 is an unconjugated rabbit polyclonal antibody to Myotilin (MYOT) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Klonalität: Polyclonal
NCBI: 9499
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:10 - 1:100), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 35kDa/55kDa, while the observed MW by Western blot was 55kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded mouse heart tissue.
Immunofluorescence analysis of U2OS cells.