Polyclonal Rabbit anti-Human MYOT / Myotilin Antibody (IHC, IF, WB) LS-C334718

Catalog Number: LS-C334718-100
Article Name: Polyclonal Rabbit anti-Human MYOT / Myotilin Antibody (IHC, IF, WB) LS-C334718
Biozol Catalog Number: LS-C334718-100
Supplier Catalog Number: LS-C334718-100
Alternative Catalog Number: LS-C334718-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 259-314 of human MYOT (NP_001129412.1). RPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL
Conjugation: Unconjugated
Alternative Names: MYOT, 57 kDa cytoskeletal protein, LGMD1, LGMD1A, TTID, Myotilin
Myotilin antibody LS-C334718 is an unconjugated rabbit polyclonal antibody to Myotilin (MYOT) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Clonality: Polyclonal
NCBI: 9499
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:10 - 1:100), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 35kDa/55kDa, while the observed MW by Western blot was 55kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded mouse heart tissue.
Immunofluorescence analysis of U2OS cells.