Macrophage Migration Inhibitory Factor, Human Recombinant (Active)
Artikelnummer:
RAY-228-11106-3
| Artikelname: |
Macrophage Migration Inhibitory Factor, Human Recombinant (Active) |
| Artikelnummer: |
RAY-228-11106-3 |
| Hersteller Artikelnummer: |
228-11106-3 |
| Alternativnummer: |
RAY-228-11106-3 |
| Hersteller: |
RayBiotech |
| Kategorie: |
Proteine/Peptide |
| Spezies Reaktivität: |
Human |
| Alternative Synonym: |
Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF. |
| NCBI: |
4282 |
| Expression System: |
E. coli |
| Reinheit: |
Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Formulierung: |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequenz: |
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA. |
| Formel: |
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5. |
| Anwendungsbeschreibung: |
It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MO-cm H2O at a concentration between 0.1mg-1mg per 1ml. |
