Macrophage Migration Inhibitory Factor, Human Recombinant (Active)
Catalog Number:
RAY-228-11106-3
| Article Name: |
Macrophage Migration Inhibitory Factor, Human Recombinant (Active) |
| Biozol Catalog Number: |
RAY-228-11106-3 |
| Supplier Catalog Number: |
228-11106-3 |
| Alternative Catalog Number: |
RAY-228-11106-3 |
| Manufacturer: |
RayBiotech |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Human |
| Alternative Names: |
Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF. |
| NCBI: |
4282 |
| Expression System: |
E. coli |
| Purity: |
Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Form: |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: |
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA. |
| Formula: |
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5. |
| Application Notes: |
It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MO-cm H2O at a concentration between 0.1mg-1mg per 1ml. |
