Hemoglobin subunit alpha (HBA1) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14551
Article Name: Hemoglobin subunit alpha (HBA1) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14551
Supplier Catalog Number: A14551
Alternative Catalog Number: ABB-A14551-20UL,ABB-A14551-100UL,ABB-A14551-1000UL,ABB-A14551-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HBH, ECYT7, HBA-T3, METHBA, Hemoglobin subunit alpha (HBA1)
The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5 untranslated regions and the introns, but they differ significantly over the 3 untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin, alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1, some nondeletion alpha thalassemias have also been reported.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 3039
UniProt: P69905
Purity: Affinity purification
Sequence: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK
Target: HBA1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. Shipping: Ice Bag
Western blot analysis of lysates from K-562 cells, using Hemoglobin subunit alpha (HBA1) Rabbit pAb (A14551) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.