TGIF1 Rabbit pAb, Polyclonal

Catalog Number: ABB-A16984
Article Name: TGIF1 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A16984
Supplier Catalog Number: A16984
Alternative Catalog Number: ABB-A16984-20UL,ABB-A16984-100UL,ABB-A16984-1000UL,ABB-A16984-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: HPE4, TGIF, TGIF1
The protein encoded by this gene is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain. Alternative splicing has been observed at this locus and multiple splice variants encoding distinct isoforms are described.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 7050
UniProt: Q15583
Purity: Affinity purification
Sequence: SSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDT
Target: TGIF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Signal Transduction,Cell Biology Developmental Biology,Neuroscience,Stem Cells,Embryonic Stem Cells,Neural Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using TGIF1 Rabbit pAb (A16984) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.