WRAP53 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20167
Article Name: WRAP53 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20167
Supplier Catalog Number: A20167
Alternative Catalog Number: ABB-A20167-100UL,ABB-A20167-20UL,ABB-A20167-1000UL,ABB-A20167-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DKCB3, TCAB1, WDR79, WRAP53
This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5 untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5 UTR have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 55135
UniProt: Q9BUR4
Purity: Affinity purification
Sequence: AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS
Target: WRAP53
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from Mouse kidney, using WRAP53 Rabbit pAb (A20167) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.