CHD3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A2221
Article Name: CHD3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A2221
Supplier Catalog Number: A2221
Alternative Catalog Number: ABB-A2221-100UL,ABB-A2221-20UL,ABB-A2221-1000UL,ABB-A2221-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZFH, Mi-2a, SNIBCPS, Mi2-ALPHA, CHD3
This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described.
Clonality: Polyclonal
Molecular Weight: 227kDa
NCBI: 1107
UniProt: Q12873
Purity: Affinity purification
Sequence: ERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD
Target: CHD3
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Chromatin Remodeling,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using CHD3 Rabbit pAb (A2221) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.