JAM-A/CD321 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23909
- Images (1)
| Article Name: | JAM-A/CD321 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23909 |
| Supplier Catalog Number: | A23909 |
| Alternative Catalog Number: | ABB-A23909-500UL,ABB-A23909-1000UL,ABB-A23909-100UL,ABB-A23909-20UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | JAM, Jcam, JAM-1, JAM-A, Jcam1, Ly106, ESTM33, 9130004G24, JAM-A/CD321 |
| Predicted to enable PDZ domain binding activity, integrin binding activity, and protein homodimerization activity. Involved in intestinal absorption, regulation of cytokine production, and regulation of membrane permeability. Acts upstream of or within cell adhesion and epithelial cell differentiation. Located in bicellular tight junction. Is expressed in several structures, including 4-8 cell stage embryo, alimentary system, respiratory system, sensory organ, and urinary system. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human F11R (F11 receptor). |
| Clonality: | Polyclonal |
| Molecular Weight: | 32kDa |
| NCBI: | 16456 |
| UniProt: | Q92993 |
| Purity: | Affinity purification |
| Sequence: | KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAA |
| Target: | CD321 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from A-431 cells, using JAM-A/CD321 Rabbit pAb (A23909) at 1:700 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
