MRPL22 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A24777
- Images (1)
| Article Name: | MRPL22 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A24777 |
| Supplier Catalog Number: | A24777 |
| Alternative Catalog Number: | ABB-A24777-20UL,ABB-A24777-100UL,ABB-A24777-1000UL,ABB-A24777-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MRPL22, HSPC158, L22mt, MRP-L22, MRP-L25, RPML25, mitochondrial ribosomal protein L22 |
| Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L22 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 4q. Two transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 13kDa/14kDa/23kDa |
| NCBI: | 29093 |
| UniProt: | Q9NWU5 |
| Purity: | Affinity purification |
| Sequence: | GEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL |
| Target: | MRPL22 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,Endocrine & Metabolism,Mitochondrial metabolism,Mitochondrial translation. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from 293T cells usingMRPL22 Rabbit pAb (A24777) at1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
