eIF4A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5294
Article Name: eIF4A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5294
Supplier Catalog Number: A5294
Alternative Catalog Number: ABB-A5294-100UL,ABB-A5294-20UL,ABB-A5294-500UL,ABB-A5294-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DDX2A, EIF4A, EIF-4A, eIF4A-I, eIF-4A-I, eIF4A1
Enables double-stranded RNA binding activity. Predicted to be involved in cytoplasmic translational initiation. Located in cytoplasm.
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 1973
UniProt: P60842
Purity: Affinity purification
Sequence: MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA
Target: EIF4A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Immunology Inflammation. Shipping: Ice Bag
Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Western blot analysis of various lysates, using eIF4A1 Rabbit pAb (A5294) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb (A5294) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 µg extracts of HeLa cells using 3 µg eIF4A1 antibody (A5294). Western blot was performed from the immunoprecipitate using eIF4A1 antibody (A5294) at a dilution of 1:1000.